PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr018920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 693aa    MW: 78268 Da    PI: 6.6194
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr018920.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3841.7e-1173206891373
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                  l++lL++cA+av++ d++ a++lL+++++++sp gd++qRla+yf+ +L+arla+ ++ +y+ l  ++ts   +++ l+a+++f   sP+  +s+++a
  Pbr018920.1 320 LRTLLTQCAQAVANYDQRTASELLQKIRHHSSPCGDANQRLAHYFADGLEARLAGATTPTYSFLVGTQTS---TADILKAYQVFISSSPFKLMSNFMA 414
                  6789************************************************************999999...8************************ PP

         GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeL 194
                  N++I++  e+++r+H+iDf+is+G+QWp+++q L++R++gpp+lRiT+++ p++g   +e++eet++rL+k+Ae+++vpfe nv +a+++e++++e+L
  Pbr018920.1 415 NRTIMKLSENATRLHVIDFGISYGFQWPCFIQHLSERTGGPPKLRITAIELPQPGfrPTERVEETARRLKKYAERFNVPFECNV-IAQKWETIKFEDL 511
                  ******************************************************9****************************9.7************ PP

         GRAS 195 rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgr 292
                  r+++ E ++Vn++ +l++++de+v  +s+rd vLkl+k+++P+v+++   +  +n++ F++rf eal++ysa+fd lea++pre+e r+  E+++ gr
  Pbr018920.1 512 RIDRSELTVVNCMCRLKHIPDETVMASSPRDIVLKLIKKINPDVFIHGVVNGTYNAPFFATRFREALYHYSAFFDILEATVPREDEMRRLFEKAIYGR 609
                  ************************************************************************************************** PP

         GRAS 293 eivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                  +ivnvvaceg er+er et+++W+ r  +aGFk++pl++   k +k++l+ +++d +r++e+ +++++ W++r+++++S+W
  Pbr018920.1 610 DIVNVVACEGLERVERPETYKQWQVRNVRAGFKQLPLDQALLKRVKRMLKSYHDD-FRIDEDGNWMLQSWRGRTILALSVW 689
                  *****************************************************66.************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.268294671IPR005202Transcription factor GRAS
PfamPF035146.0E-115320689IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 693 aa     Download sequence    Send to blast
MDTLLERYDV SVERLNFGSV YPHQNLVNGF KVNHESTNSI FPPTNLDHNS SDSSTYSSTG  60
SDGDSIDPND FNHPMLKYIS DILLEEDLEG KPCMMQGCLA LQAAEKSFFD VLNPKGPPSP  120
NQPPLSHSLE NSDDDSTPSF HSGNGSSIAA KTDWGFDSSE TSHFQSSLVE SQSDNLLVSD  180
LLSELQSSGH FGGVGEASKF LPNGSFGTFD QERNHLMHPG PDLRPPGTRT LVRRPENYGY  240
NSTNILKGKK NHQREDVDYP EEGRSSKLPV AFADDSEPPQ EMFDEVLLCH GHHRLGNKQA  300
KGAKTTRSKK QNNNTEMVDL RTLLTQCAQA VANYDQRTAS ELLQKIRHHS SPCGDANQRL  360
AHYFADGLEA RLAGATTPTY SFLVGTQTST ADILKAYQVF ISSSPFKLMS NFMANRTIMK  420
LSENATRLHV IDFGISYGFQ WPCFIQHLSE RTGGPPKLRI TAIELPQPGF RPTERVEETA  480
RRLKKYAERF NVPFECNVIA QKWETIKFED LRIDRSELTV VNCMCRLKHI PDETVMASSP  540
RDIVLKLIKK INPDVFIHGV VNGTYNAPFF ATRFREALYH YSAFFDILEA TVPREDEMRR  600
LFEKAIYGRD IVNVVACEGL ERVERPETYK QWQVRNVRAG FKQLPLDQAL LKRVKRMLKS  660
YHDDFRIDED GNWMLQSWRG RTILALSVWV PA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-423206895374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008359011.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5W7W50.0M5W7W5_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14